PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009761438.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 487aa    MW: 53988.8 Da    PI: 5.518
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009761438.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.88.7e-37140199261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+l+cprC+st+tkfCyynn +++qPr+fC++C+ryWt+GG++rn+PvG+grrknk+ 
  XP_009761438.1 140 PDKILPCPRCNSTDTKFCYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNL 199
                     7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-28137197IPR003851Zinc finger, Dof-type
PfamPF027016.4E-31142198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.922144198IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MTCESEIKLF GKILPMVVSG ESTGAGRSRI DNRISTGFDV DQYLEDNRTS SSENDEGSES  60
IDYENQTADK DNISGELSKD KLEEEDQNQM MEISEDPKIS SESDYSPKSP TDEDPQTVKS  120
AENENEPNNA TDSQQTLKKP DKILPCPRCN STDTKFCYYN NNNVNQPRHF CRSCQRYWTA  180
GGTMRNLPVG AGRRKNKNLA SHYRHISIPD DVLLAAQIES PNGFHHPMYK PNGTVLSFGP  240
ELPLCESMAS ALNPAEKRAP NVIPNGFYKQ EHRNSSCKGG ENGDDCSKGS SIKTSNMMVE  300
GGNSKPHEAV MRNINGFLSP APCFHGVPFP FPWNAAVPMS AIYPFGFPMP FYPAPYWNCS  360
VPRWSNPWLS QPCRTENEKA SGSDPNSPLG KHSREGDDPE GNEPVEQKSS KRSILVPKTL  420
RIDDPDEAAK SSIWSTLGIK YDSASRGGFF KALQPKIDDR DHKDNTSPVL HANPAALSRS  480
LVLQERT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761438.10.0PREDICTED: cyclic dof factor 3-like
RefseqXP_016484450.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLM1D6F90.0M1D6F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000830800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.13e-85cycling DOF factor 3